Lineage for d1uufa2 (1uuf A:145-312)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1576365Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 1576622Protein Hypothetical protein YahK [102128] (1 species)
  7. 1576623Species Escherichia coli [TaxId:562] [102129] (1 PDB entry)
  8. 1576624Domain d1uufa2: 1uuf A:145-312 [100007]
    Other proteins in same PDB: d1uufa1
    complexed with zn

Details for d1uufa2

PDB Entry: 1uuf (more details), 1.76 Å

PDB Description: crystal structure of a zinc-type alcohol dehydrogenase-like protein yahk
PDB Compounds: (A:) zinc-type alcohol dehydrogenase-like protein yahk

SCOPe Domain Sequences for d1uufa2:

Sequence, based on SEQRES records: (download)

>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]}
hpqeqlaavapllcagittysplrhwqagpgkkvgvvgigglghmgiklahamgahvvaf
ttseakreaakalgadevvnsrnademaahlksfdfilntvaaphnlddfttllkrdgtm
tlvgapatphkspevfnlimkrraiagsmiggipetqemldfcaehgi

Sequence, based on observed residues (ATOM records): (download)

>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]}
hpqeqlaavapllcagittysplrhwqagpgkkvgvvgigglghmgiklahamgahvvaf
ttseakreaakalgadevvnsrnademaahlksfdfilntvaaphnlddfttllkrdgtm
tlvgapevfnlimkrraiagsmiggipetqemldfcaehgi

SCOPe Domain Coordinates for d1uufa2:

Click to download the PDB-style file with coordinates for d1uufa2.
(The format of our PDB-style files is described here.)

Timeline for d1uufa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uufa1