![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
![]() | Protein Hypothetical protein YahK [102128] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102129] (1 PDB entry) |
![]() | Domain d1uufa2: 1uuf A:145-312 [100007] Other proteins in same PDB: d1uufa1 complexed with zn |
PDB Entry: 1uuf (more details), 1.76 Å
SCOPe Domain Sequences for d1uufa2:
Sequence, based on SEQRES records: (download)
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} hpqeqlaavapllcagittysplrhwqagpgkkvgvvgigglghmgiklahamgahvvaf ttseakreaakalgadevvnsrnademaahlksfdfilntvaaphnlddfttllkrdgtm tlvgapatphkspevfnlimkrraiagsmiggipetqemldfcaehgi
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} hpqeqlaavapllcagittysplrhwqagpgkkvgvvgigglghmgiklahamgahvvaf ttseakreaakalgadevvnsrnademaahlksfdfilntvaaphnlddfttllkrdgtm tlvgapevfnlimkrraiagsmiggipetqemldfcaehgi
Timeline for d1uufa2: