Lineage for d6qhba_ (6qhb A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) 
Protein Kallikrein 6 [74974] (1 species) Species Human (Homo sapiens) [TaxId:9606] [74975] (17 PDB entries) 
Domain d6qhba_: 6qhb A: [364715]
automated match to d1gvla_
complexed with gol, j2w
Details for d6qhba_
PDB Entry: 6qhb (more details), 1.84 Å
PDB Description: crystal structure of human kallikrein 6 in complex with gsk578724a
PDB Compounds: (A:) Kallikrein-6SCOPe Domain Sequences for d6qhba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qhba_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]}
lvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlgqqe
ssqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsaqttschil
gwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggpl
vcgdhlrglvswgnipcgskekpgvytnvcrytnwiqktiqak
SCOPe Domain Coordinates for d6qhba_:
Click to download the PDB-style file with coordinates for d6qhba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6qhba_:
- d6qhba_ first appeared in SCOPe 2.07
View in 3D
