Lineage for d6citb_ (6cit B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helixSuperfamily b.55.1: PH domain-like [50729] (14 families) 
Family b.55.1.0: automated matches [191311] (1 protein)
not a true familyProtein automated matches [190052] (8 species)
not a true protein
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (63 PDB entries) 
Domain d6citb_: 6cit B: [353874]
Other proteins in same PDB: d6cita_
automated match to d5uwsb_
complexed with cl, gnp, gol, mg
Details for d6citb_
PDB Entry: 6cit (more details), 2.03 Å
PDB Description: crystal structure of mvm ns2 nes peptide in complex with crm1-ran- ranbp1
PDB Compounds: (B:) Ran-specific GTPase-activating protein 1SCOPe Domain Sequences for d6citb_:
Sequence, based on SEQRES records: (download)
>d6citb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkv
rilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgske
nadkfkeefekaqeinkka
Sequence, based on observed residues (ATOM records): (download)
>d6citb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvtmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdk
tlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkee
fekaqeinkka
SCOPe Domain Coordinates for d6citb_:
Click to download the PDB-style file with coordinates for d6citb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6citb_:
- d6citb_ first appeared in SCOPe 2.07
View in 3D
