Lineage for d5ym6b_ (5ym6 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824768Fold b.140: Replicase NSP9 [101815] (1 superfamily)
    barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel
  4. 2824769Superfamily b.140.1: Replicase NSP9 [101816] (2 families) (S)
  5. 2824799Family b.140.1.0: automated matches [191526] (1 protein)
    not a true family
  6. 2824800Protein automated matches [190886] (4 species)
    not a true protein
  7. 2824807Species Porcine coronavirus hku15 [TaxId:1159905] [353578] (2 PDB entries)
  8. 2824809Domain d5ym6b_: 5ym6 B: [353592]
    automated match to d1qz8b_

Details for d5ym6b_

PDB Entry: 5ym6 (more details), 1.8 Å

PDB Description: crystal structure of porcine delta coronavirus nsp9
PDB Compounds: (B:) nsp9

SCOPe Domain Sequences for d5ym6b_:

Sequence, based on SEQRES records: (download)

>d5ym6b_ b.140.1.0 (B:) automated matches {Porcine coronavirus hku15 [TaxId: 1159905]}
nnelclrnvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtcltetgk
tvlnldppmrfahtvggkqsvvylyfiqnisslnrgmvighisett

Sequence, based on observed residues (ATOM records): (download)

>d5ym6b_ b.140.1.0 (B:) automated matches {Porcine coronavirus hku15 [TaxId: 1159905]}
nnelclrnvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtclttgkt
vlnldppmrfaqsvvylyfiqnisslnrgmvighisett

SCOPe Domain Coordinates for d5ym6b_:

Click to download the PDB-style file with coordinates for d5ym6b_.
(The format of our PDB-style files is described here.)

Timeline for d5ym6b_: