Class b: All beta proteins [48724] (180 folds) |
Fold b.140: Replicase NSP9 [101815] (1 superfamily) barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel |
Superfamily b.140.1: Replicase NSP9 [101816] (2 families) |
Family b.140.1.0: automated matches [191526] (1 protein) not a true family |
Protein automated matches [190886] (4 species) not a true protein |
Species Porcine coronavirus hku15 [TaxId:1159905] [353578] (2 PDB entries) |
Domain d5ym6b_: 5ym6 B: [353592] automated match to d1qz8b_ |
PDB Entry: 5ym6 (more details), 1.8 Å
SCOPe Domain Sequences for d5ym6b_:
Sequence, based on SEQRES records: (download)
>d5ym6b_ b.140.1.0 (B:) automated matches {Porcine coronavirus hku15 [TaxId: 1159905]} nnelclrnvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtcltetgk tvlnldppmrfahtvggkqsvvylyfiqnisslnrgmvighisett
>d5ym6b_ b.140.1.0 (B:) automated matches {Porcine coronavirus hku15 [TaxId: 1159905]} nnelclrnvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtclttgkt vlnldppmrfaqsvvylyfiqnisslnrgmvighisett
Timeline for d5ym6b_: