PDB entry 5ym6

View 5ym6 on RCSB PDB site
Description: Crystal Structure of porcine delta coronavirus nsp9
Class: RNA binding protein
Keywords: Porcine delta coronavirus, RNA binding protein, nsp9
Deposited on 2017-10-21, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nsp9
    Species: Porcine coronavirus HKU15 [TaxId:1159905]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ym6a_
  • Chain 'B':
    Compound: nsp9
    Species: Porcine coronavirus HKU15 [TaxId:1159905]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ym6b_
  • Chain 'C':
    Compound: nsp9
    Species: Porcine coronavirus HKU15 [TaxId:1159905]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ym6c_
  • Chain 'D':
    Compound: nsp9
    Species: Porcine coronavirus HKU15 [TaxId:1159905]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ym6d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ym6A (A:)
    nnelclrnvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtcltetgk
    tvlnldppmrfahtvggkqsvvylyfiqnisslnrgmvighisettilqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ym6A (A:)
    nnelclrnvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtcltetgk
    tvlnldppmrfsvvylyfiqnisslnrgmvighiset
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ym6B (B:)
    nnelclrnvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtcltetgk
    tvlnldppmrfahtvggkqsvvylyfiqnisslnrgmvighisettilqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ym6B (B:)
    nnelclrnvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtclttgkt
    vlnldppmrfaqsvvylyfiqnisslnrgmvighisett
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ym6C (C:)
    nnelclrnvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtcltetgk
    tvlnldppmrfahtvggkqsvvylyfiqnisslnrgmvighisettilqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ym6C (C:)
    nnelclrnvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtclttgkt
    vlnldppmrfahsvvylyfiqnisslnrgmvighisett
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ym6D (D:)
    nnelclrnvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtcltetgk
    tvlnldppmrfahtvggkqsvvylyfiqnisslnrgmvighisettilqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ym6D (D:)
    nnelclrnvftaqntaqdfngnestvksfyvtrkkilvaitstkdnlktvtcltetgktv
    lnldppmrfsvvylyfiqnisslnrgmvighiset