Lineage for d5i2kb_ (5i2k B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162749Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species)
  7. 2162750Species Homo sapiens [TaxId:9606] [314718] (12 PDB entries)
  8. 2162762Domain d5i2kb_: 5i2k B: [315008]
    Other proteins in same PDB: d5i2ka_
    automated match to d1pb7a_
    complexed with 67h, glu, gly

Details for d5i2kb_

PDB Entry: 5i2k (more details), 2.86 Å

PDB Description: structure of the human glun1/glun2a lbd in complex with 7-{[ethyl(4- fluorophenyl)amino]methyl}-n,2-dimethyl-5-oxo-5h-[1,3]thiazolo[3,2- a]pyrimidine-3-carboxamide (compound 19)
PDB Compounds: (B:) Glutamate receptor ionotropic, NMDA 1

SCOPe Domain Sequences for d5i2kb_:

Sequence, based on SEQRES records: (download)

>d5i2kb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]}
mstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq
ccygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmi
vapltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssv
diyfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvtt
gelffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqec

Sequence, based on observed residues (ATOM records): (download)

>d5i2kb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]}
mstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq
ccygfcidlliklartmnftyevhlvadgkfgtqervnkkewngmmgellsgqadmivap
ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy
frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel
ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqec

SCOPe Domain Coordinates for d5i2kb_:

Click to download the PDB-style file with coordinates for d5i2kb_.
(The format of our PDB-style files is described here.)

Timeline for d5i2kb_: