Lineage for d5fg9h_ (5fg9 H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600468Domain d5fg9h_: 5fg9 H: [314117]
    Other proteins in same PDB: d5fg9a_, d5fg9e_, d5fg9g_, d5fg9i_, d5fg9j_, d5fg9k_, d5fg9l_, d5fg9n_, d5fg9o_, d5fg9s_, d5fg9u_, d5fg9w_, d5fg9x_, d5fg9y_, d5fg9z_
    automated match to d4r17h_
    complexed with mg; mutant

Details for d5fg9h_

PDB Entry: 5fg9 (more details), 2.6 Å

PDB Description: yeast 20s proteasome beta2-t(-2)v mutant
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5fg9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fg9h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tsvgttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavt
qligsnielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihah
gstdvgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvc
vmeigkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d5fg9h_:

Click to download the PDB-style file with coordinates for d5fg9h_.
(The format of our PDB-style files is described here.)

Timeline for d5fg9h_: