Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries) |
Domain d5d3yb_: 5d3y B: [316048] automated match to d1pmsa_ complexed with 4ip |
PDB Entry: 5d3y (more details), 1.95 Å
SCOPe Domain Sequences for d5d3yb_:
Sequence, based on SEQRES records: (download)
>d5d3yb_ b.55.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aleqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyckrksrvt gskkstkrtksingslyifrgrintevmevenvedgtadyhsngytvtngwkihntaknk wfvcmaktaeekqkwldaiirereqreslkl
>d5d3yb_ b.55.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aleqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyckrksrvs lyifrgrintevmevenvedgtadyhsngytvtngwkihntaknkwfvcmaktaeekqkw ldaiirereqreslkl
Timeline for d5d3yb_: