Lineage for d1pmsa_ (1pms A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803293Protein Son of sevenless-1 (sos-1) [50742] (2 species)
  7. 2803301Species Mouse (Mus musculus) [TaxId:10090] [50743] (1 PDB entry)
  8. 2803302Domain d1pmsa_: 1pms A: [26966]

Details for d1pmsa_

PDB Entry: 1pms (more details)

PDB Description: pleckstrin homology domain of son of sevenless 1 (sos1) with glycine- serine added to the n-terminus, nmr, 20 structures
PDB Compounds: (A:) sos 1

SCOPe Domain Sequences for d1pmsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmsa_ b.55.1.1 (A:) Son of sevenless-1 (sos-1) {Mouse (Mus musculus) [TaxId: 10090]}
skqlaikkmneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccks
nhgqprlpgassaeyrlkekffmrkvqindkddtseykhafeiilkdgnsvifsaksaee
knnwmaalislqyrs

SCOPe Domain Coordinates for d1pmsa_:

Click to download the PDB-style file with coordinates for d1pmsa_.
(The format of our PDB-style files is described here.)

Timeline for d1pmsa_: