Lineage for d5a1fa2 (5a1f A:623-753)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039154Fold g.102: Jumonji C-terminal domain-like [418708] (1 superfamily)
    alpha + beta fold, with C5HC2 zinc finger binding 2 zinc ions
  4. 3039155Superfamily g.102.1: Jumonji C-terminal domain-like [418737] (2 families) (S)
  5. 3039156Family g.102.1.1: Jumonji C-terminal domain [418787] (1 protein)
    Pfam PF02928
  6. 3039157Protein KDM5B (JARID1B or PLU1) C-terminal domain [419086] (1 species)
  7. 3039158Species Human (Homo sapiens) [TaxId:9606] [419583] (14 PDB entries)
  8. 3039164Domain d5a1fa2: 5a1f A:623-753 [414553]
    Other proteins in same PDB: d5a1fa1, d5a1fa3
    complexed with edo, epe, mn, oga, po4, zn

Details for d5a1fa2

PDB Entry: 5a1f (more details), 2.1 Å

PDB Description: crystal structure of the catalytic domain of plu1 in complex with n-oxalylglycine.
PDB Compounds: (A:) lysine-specific demethylase 5b, lysine-specific demethylase 5b

SCOPe Domain Sequences for d5a1fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a1fa2 g.102.1.1 (A:623-753) KDM5B (JARID1B or PLU1) C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rycvfshdemickmaskadvldvvvastvqkdmaimiedekalretvrklgvidsermdf
ellpdderqcvkckttcfmsaiscsckpgllvclhhvkelcscppykyklryrytlddly
pmmnalklrae

SCOPe Domain Coordinates for d5a1fa2:

Click to download the PDB-style file with coordinates for d5a1fa2.
(The format of our PDB-style files is described here.)

Timeline for d5a1fa2:

  • d5a1fa2 is new in SCOPe 2.08-stable