Lineage for d4yeta2 (4yet A:84-199)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946342Species Babesia bovis [TaxId:5865] [226663] (1 PDB entry)
  8. 2946343Domain d4yeta2: 4yet A:84-199 [271598]
    Other proteins in same PDB: d4yeta1, d4yetb1, d4yetb3
    automated match to d4k2wa2
    complexed with fe

Details for d4yeta2

PDB Entry: 4yet (more details), 1.75 Å

PDB Description: x-ray crystal structure of superoxide dismutase from babesia bovis solved by sulfur sad
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4yeta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yeta2 d.44.1.0 (A:84-199) automated matches {Babesia bovis [TaxId: 5865]}
ncggeptgpirkkieekfgsfsafktdfsnllaghfgsgwgwlvlkddgtadivqthdag
splkenlgrpllccdvwehayyidykndrlsyinswwnlvnwdfanknleapfkws

SCOPe Domain Coordinates for d4yeta2:

Click to download the PDB-style file with coordinates for d4yeta2.
(The format of our PDB-style files is described here.)

Timeline for d4yeta2:

2946343
d4yeta2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4yeta1