PDB entry 4yet

View 4yet on RCSB PDB site
Description: X-ray crystal structure of superoxide dismutase from Babesia bovis solved by Sulfur SAD
Class: oxidoreductase
Keywords: superoxide dismutase, SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2015-02-24, released 2015-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Babesia bovis [TaxId:5865]
    Gene: Fe-SOD, BBOV_IV011480
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yeta1, d4yeta2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Babesia bovis [TaxId:5865]
    Gene: Fe-SOD, BBOV_IV011480
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15904 (4-202)
      • expression tag (3)
    Domains in SCOPe 2.07: d4yetb1, d4yetb2, d4yetb3
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yetA (A:)
    gpgsmafklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieel
    ilgqtgavfnnaaqiwnhtfywnsmgpncggeptgpirkkieekfgsfsafktdfsnlla
    ghfgsgwgwlvlkddgtadivqthdagsplkenlgrpllccdvwehayyidykndrlsyi
    nswwnlvnwdfanknleapfkws
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yetA (A:)
    afklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieelilgqt
    gavfnnaaqiwnhtfywnsmgpncggeptgpirkkieekfgsfsafktdfsnllaghfgs
    gwgwlvlkddgtadivqthdagsplkenlgrpllccdvwehayyidykndrlsyinswwn
    lvnwdfanknleapfkws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yetB (B:)
    gpgsmafklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieel
    ilgqtgavfnnaaqiwnhtfywnsmgpncggeptgpirkkieekfgsfsafktdfsnlla
    ghfgsgwgwlvlkddgtadivqthdagsplkenlgrpllccdvwehayyidykndrlsyi
    nswwnlvnwdfanknleapfkws
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yetB (B:)
    smafklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieelilg
    qtgavfnnaaqiwnhtfywnsmgpncggeptgpirkkieekfgsfsafktdfsnllaghf
    gsgwgwlvlkddgtadivqthdagsplkenlgrpllccdvwehayyidykndrlsyinsw
    wnlvnwdfanknleapfkws