SCOPe 2.08: Domain d4yetb1: 4yet B:1-83

Lineage for d4yetb1 (4yet B:1-83)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Babesia bovis [TaxId:5865] [226662] (1 PDB entry)

8. Domain d4yetb1: 4yet B:1-83 [271599]
   Other proteins in same PDB: d4yeta2, d4yetb2, d4yetb3
   automated match to d4k2wa1
   complexed with fe

Details for d4yetb1

PDB Entry: 4yet, 1.75 Å

PDB Description: x-ray crystal structure of superoxide dismutase from babesia bovis solved by sulfur sad

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d4yetb1:

Sequence; same for both SEQRES and ATOM records:

>d4yetb1 a.2.11.0 (B:1-83) automated matches {Babesia bovis [TaxId: 5865]}
mafklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieelilgq
tgavfnnaaqiwnhtfywnsmgp

Timeline for d4yetb1:

• d4yetb1 first appeared in SCOPe 2.05
  
• d4yetb1 appears in SCOPe 2.07