Lineage for d4uoha_ (4uoh A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194897Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2194898Protein automated matches [191087] (14 species)
    not a true protein
  7. 2195017Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [259554] (3 PDB entries)
  8. 2195018Domain d4uoha_: 4uoh A: [259555]
    automated match to d4f36e_
    complexed with adp, mg

Details for d4uoha_

PDB Entry: 4uoh (more details), 2.01 Å

PDB Description: Crystallographic structure of nucleoside diphosphate kinase from Litopenaeus vannamei complexed with ADP
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4uoha_:

Sequence, based on SEQRES records: (download)

>d4uoha_ d.58.6.0 (A:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvrertfiavkpdgvqrgligeiikrfeakgfklagmkyiqasedllkqhyidladkpfy
pglckymssgpvvamcwegtgvvktarvmmgetrpadskpgtirgdfcievgrniihgsd
svesankeialwfkpeelvswtqtneswiye

Sequence, based on observed residues (ATOM records): (download)

>d4uoha_ d.58.6.0 (A:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvrertfiavkpdgvqrgligeiikrfeakgfklagmkyiqasmssgpvvamcwegtgvv
ktarvmmgetrpadskpgtirgdfcievgrniihgsdsvesankeialwfkpeelvswtq
tneswiye

SCOPe Domain Coordinates for d4uoha_:

Click to download the PDB-style file with coordinates for d4uoha_.
(The format of our PDB-style files is described here.)

Timeline for d4uoha_: