SCOPe 2.06: Domain d4uohb_: 4uoh B:

Lineage for d4uohb_ (4uoh B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.0: automated matches [191597] (1 protein)
   not a true family

6. Protein automated matches [191087] (14 species)
   not a true protein

7. Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [259554] (3 PDB entries)

8. Domain d4uohb_: 4uoh B: [263987]
   automated match to d4uoha_
   complexed with adp, mg

Details for d4uohb_

PDB Entry: 4uoh, 2.01 Å

PDB Description: Crystallographic structure of nucleoside diphosphate kinase from Litopenaeus vannamei complexed with ADP

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4uohb_:

Sequence; same for both SEQRES and ATOM records:

>d4uohb_ d.58.6.0 (B:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvrertfiavkpdgvqrgligeiikrfeakgfklagmkyiqasedllkqhyidladkpfy
pglckymssgpvvamcwegtgvvktarvmmgetrpadskpgtirgdfcievgrniihgsd
svesankeialwfkpeelvswtqtneswiye

Timeline for d4uohb_:

• d4uohb_ first appeared in SCOPe 2.05
  
• d4uohb_ appears in SCOPe 2.07
  
• d4uohb_ appears in the current release, SCOPe 2.08