Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
Protein automated matches [191087] (14 species) not a true protein |
Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [259554] (3 PDB entries) |
Domain d4uohb_: 4uoh B: [263987] automated match to d4uoha_ complexed with adp, mg |
PDB Entry: 4uoh (more details), 2.01 Å
SCOPe Domain Sequences for d4uohb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uohb_ d.58.6.0 (B:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]} mvrertfiavkpdgvqrgligeiikrfeakgfklagmkyiqasedllkqhyidladkpfy pglckymssgpvvamcwegtgvvktarvmmgetrpadskpgtirgdfcievgrniihgsd svesankeialwfkpeelvswtqtneswiye
Timeline for d4uohb_: