Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
Protein automated matches [190854] (25 species) not a true protein |
Species Coxsackievirus a24 [TaxId:12089] [260750] (4 PDB entries) |
Domain d4q4y3_: 4q4y 3: [260752] automated match to d1hxs3_ complexed with ca, cl, hez, mg, myr, sia |
PDB Entry: 4q4y (more details), 1.88 Å
SCOPe Domain Sequences for d4q4y3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q4y3_ b.121.4.1 (3:) automated matches {Coxsackievirus a24 [TaxId: 12089]} glptmltpgssqfltsddfqspcalpnfdvtppihipgevfnmmelaeidsmipmnsvtg kantmemypiplddkgsatpifsislspasdkrlqytmlgeilnyythwtgslrftflfc gsmmatgkillsysppgakppttrkdamlgthiiwdlglqssctmlapwisntvyrrcik ddfteggyitcfyqtrivvpsgtptsmfmlafvsacpdfsvrllrdtnhisqrt
Timeline for d4q4y3_: