Lineage for d4pzya_ (4pzy A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the restProtein automated matches [190047] (27 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [186768] (145 PDB entries) 
Domain d4pzya_: 4pzy A: [259462]
automated match to d4epva_
complexed with 2xr, gdp, mg
Details for d4pzya_
PDB Entry: 4pzy (more details), 1.88 Å
PDB Description: Second-site screening of K-Ras in the presence of covalently attached first-site ligands
PDB Compounds: (A:) K-RasSCOPe Domain Sequences for d4pzya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pzya_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
gqeeysamrdcymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
SCOPe Domain Coordinates for d4pzya_:
Click to download the PDB-style file with coordinates for d4pzya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4pzya_:
- d4pzya_ first appeared in SCOPe 2.04
- d4pzya_ is called d4pzya1 in SCOPe 2.06
- d4pzya_ appears in the current release, SCOPe 2.08, called d4pzya1
View in 3D
