PDB entry 4pzy

View 4pzy on RCSB PDB site
Description: Second-site screening of K-Ras in the presence of covalently attached first-site ligands
Class: hydrolase
Keywords: small GTPase, signaling transduction, SOS, Raf, cytosol, HYDROLASE
Deposited on 2014-03-31, released 2014-09-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.188
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: K-Ras
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01116 (1-169)
    • expression tag (0)
    • engineered mutation (12)
    • engineered mutation (70)
    • engineered mutation (118)
  Domains in SCOPe 2.05: d4pzya_
• Chain 'B':
  Compound: K-Ras
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01116 (1-169)
    • expression tag (0)
    • engineered mutation (12)
    • engineered mutation (70)
    • engineered mutation (118)
  Domains in SCOPe 2.05: d4pzyb_
• Heterogens: GDP, MG, 2XR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4pzyA (A:)
  gmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
  gqeeysamrdcymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
  lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4pzyB (B:)
  gmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
  gqeeysamrdcymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
  lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek