Lineage for d4nuub_ (4nuu B:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.264: Duffy binding domain-like [140923] (1 superfamily)
consist of two subdomains, each containing a three-helical bundleSuperfamily a.264.1: Duffy binding domain-like [140924] (2 families) 
automatically mapped to Pfam PF05424Family a.264.1.1: Duffy binding domain [140925] (3 proteins)
Pfam PF05424Protein automated matches [191262] (1 species)
not a true proteinSpecies Plasmodium vivax [TaxId:126793] [189825] (4 PDB entries) 
Domain d4nuub_: 4nuu B: [236628]
automated match to d3rrca_
Details for d4nuub_
PDB Entry: 4nuu (more details), 1.95 Å
PDB Description: heterotrimer structure of region ii from plasmodium vivax duffy binding protein (pvdbp) bound to the ectodomain of the duffy antigen receptor for chemokines (darc)
PDB Compounds: (B:) Duffy receptorSCOPe Domain Sequences for d4nuub_:
Sequence, based on SEQRES records: (download)
>d4nuub_ a.264.1.1 (B:) automated matches {Plasmodium vivax [TaxId: 126793]}
asntvmkncnykrkrrerdwdcntkkdvcipdrryqlcmkeltnlvnntdtnfhrditfr
klylkrkliydaavegdlllklnnyrynkdfckdirwslgdfgdiimgtdmegigyskvv
ennlrsifgtdekaqqrrkqwwneskaqiwtammysvkkrlkgnfiwicklnvavniepq
iyrwirewgrdyvselptevqklkekcdgkinytdkkvckvppcqnacksydqwitrkkn
qwdvlsnkfisvknaekvqtagivtpydilkqeldefnevafeneinkrdgayielcvcs
Sequence, based on observed residues (ATOM records): (download)
>d4nuub_ a.264.1.1 (B:) automated matches {Plasmodium vivax [TaxId: 126793]}
asntvmkncnykrkrrerdwdcntkkdvcipdrryqlcmkeltnlfhrditfrklylkrk
liydaavegdlllklnnyrynkdfckdirwslgdfgdiimgtdmegigyskvvennlrsi
fgtdekaqqrrkqwwneskaqiwtammysvkkrlkgnfiwicklnvavniepqiyrwire
wgrdyvselptevqklkekcdgkinytdkkvckvppcqnacksydqwitrkknqwdvlsn
kfisvknaekqtagivtpydilkqeldefnevafeneinkrdgayielcvcs
SCOPe Domain Coordinates for d4nuub_:
Click to download the PDB-style file with coordinates for d4nuub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4nuub_:
- d4nuub_ first appeared in SCOPe 2.03
- d4nuub_ appears in SCOPe 2.04
- d4nuub_ is called d4nuub1 in SCOPe 2.06
- d4nuub_ appears in the current release, SCOPe 2.08, called d4nuub1
View in 3D
