Lineage for d4mpna1 (4mpn A:12-177)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topology
Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) 
automatically mapped to Pfam PF10436
Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins) Protein automated matches [230549] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [230552] (13 PDB entries) 
Domain d4mpna1: 4mpn A:12-177 [253825]
Other proteins in same PDB: d4mpna2
automated match to d2bu8a1
complexed with pv0, tla
Details for d4mpna1
PDB Entry: 4mpn (more details), 1.75 Å
PDB Description: Crystal structure of pyruvate dehydrogenase kinase isoform 2 in complex with inhibitor PS10
PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrialSCOPe Domain Sequences for d4mpna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mpna1 a.29.5.1 (A:12-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinll
pdrvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptma
qgvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd
SCOPe Domain Coordinates for d4mpna1:
Click to download the PDB-style file with coordinates for d4mpna1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4mpna1:
- d4mpna1 is new in SCOPe 2.04-stable
- d4mpna1 appears in SCOPe 2.05
- d4mpna1 appears in the current release, SCOPe 2.08
View in 3D
