Lineage for d2bu8a1 (2bu8 A:6-169)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topology
Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) 
automatically mapped to Pfam PF10436
Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins) Protein automated matches [230549] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [230552] (13 PDB entries) 
Domain d2bu8a1: 2bu8 A:6-169 [230553]
Other proteins in same PDB: d2bu8a2
automated match to d1jm6a1
complexed with adp, mg, tf4
Details for d2bu8a1
PDB Entry: 2bu8 (more details), 2.5 Å
PDB Description: crystal structures of human pyruvate dehydrogenase kinase 2 containing physiological and synthetic ligands
PDB Compounds: (A:) pyruvate dehydrogenase kinase isoenzyme 2SCOPe Domain Sequences for d2bu8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bu8a1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinllpd
rvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqg
vleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd
SCOPe Domain Coordinates for d2bu8a1:
Click to download the PDB-style file with coordinates for d2bu8a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bu8a1:
- d2bu8a1 first appeared in SCOPe 2.03
- d2bu8a1 appears in SCOPe 2.05
- d2bu8a1 appears in the current release, SCOPe 2.08
View in 3D
