Lineage for d4mmga_ (4mmg A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.298: RelE-like [143010] (1 superfamily)
beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432Superfamily d.298.1: RelE-like [143011] (3 families) 
Toxin component of plasmid stabilisation system
Family d.298.1.0: automated matches [191658] (1 protein)
not a true familyProtein automated matches [191236] (5 species)
not a true proteinSpecies Escherichia coli [TaxId:83333] [257085] (4 PDB entries) 
Domain d4mmga_: 4mmg A: [257087]
automated match to d2otra_
complexed with so4; mutant
Details for d4mmga_
PDB Entry: 4mmg (more details), 1.5 Å
PDB Description: crystal structure of yafq mutant h87q from e.coli
PDB Compounds: (A:) mRNA interferase YafQSCOPe Domain Sequences for d4mmga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mmga_ d.298.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
iqrdieysgqyskdvklaqkrhkdmnklkylmtllinntlplpavykdhplqgswkgyrd
ahvepdwiliykltdkllrfertgtqaalfg
SCOPe Domain Coordinates for d4mmga_:
Click to download the PDB-style file with coordinates for d4mmga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4mmga_:
- d4mmga_ first appeared in SCOPe 2.04
- d4mmga_ appears in SCOPe 2.05
- d4mmga_ appears in SCOPe 2.07
- d4mmga_ appears in the current release, SCOPe 2.08
View in 3D
