Lineage for d4mmga_ (4mmg A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1688581Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 1688582Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 1688614Family d.298.1.0: automated matches [191658] (1 protein)
    not a true family
  6. 1688615Protein automated matches [191236] (5 species)
    not a true protein
  7. 1688621Species Escherichia coli [TaxId:83333] [257085] (3 PDB entries)
  8. 1688622Domain d4mmga_: 4mmg A: [257087]
    automated match to d2otra_
    complexed with so4; mutant

Details for d4mmga_

PDB Entry: 4mmg (more details), 1.5 Å

PDB Description: crystal structure of yafq mutant h87q from e.coli
PDB Compounds: (A:) mRNA interferase YafQ

SCOPe Domain Sequences for d4mmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mmga_ d.298.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
iqrdieysgqyskdvklaqkrhkdmnklkylmtllinntlplpavykdhplqgswkgyrd
ahvepdwiliykltdkllrfertgtqaalfg

SCOPe Domain Coordinates for d4mmga_:

Click to download the PDB-style file with coordinates for d4mmga_.
(The format of our PDB-style files is described here.)

Timeline for d4mmga_: