Lineage for d4lo0a2 (4lo0 A:152-293)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401663Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2401897Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2401898Protein automated matches [226913] (9 species)
    not a true protein
  7. 2401921Species Clostridium botulinum [TaxId:1491] [254975] (8 PDB entries)
  8. 2401935Domain d4lo0a2: 4lo0 A:152-293 [253657]
    Other proteins in same PDB: d4lo0a3, d4lo0b3
    automated match to d2e4ma2

Details for d4lo0a2

PDB Entry: 4lo0 (more details), 2.06 Å

PDB Description: apo ha17-ha33
PDB Compounds: (A:) ha-33

SCOPe Domain Sequences for d4lo0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lo0a2 b.42.2.0 (A:152-293) automated matches {Clostridium botulinum [TaxId: 1491]}
nftckispildlnkvvqqvdvtnlnvnlytwdygrnqkwtiryneekaayqffntilsng
vltwifsngntvrvsssndqnndaqywlinpvsdtdetytitnlrdttkaldlyggqtan
gtaiqvfnyhgddnqkwnirnp

SCOPe Domain Coordinates for d4lo0a2:

Click to download the PDB-style file with coordinates for d4lo0a2.
(The format of our PDB-style files is described here.)

Timeline for d4lo0a2: