Class b: All beta proteins [48724] (180 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) two constituent families are related by circular permutation |
Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
Protein automated matches [190497] (4 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (10 PDB entries) |
Domain d4lcvd_: 4lcv D: [227893] Other proteins in same PDB: d4lcvb2 automated match to d2chda_ complexed with bme, ca, flc, so4 |
PDB Entry: 4lcv (more details), 2 Å
SCOPe Domain Sequences for d4lcvd_:
Sequence, based on SEQRES records: (download)
>d4lcvd_ b.7.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} algtldfsllydqennalhctiskakglkpmdhngladpyvklhllpgaskanklrtktl rntlnpswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkklkpnhtkt fsiclekql
>d4lcvd_ b.7.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} algtldfsllydqennalhctiskakglkpmdladpyvklhllpgaskanklrtktlrnt lnpswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkklkpnhtktfsi clekql
Timeline for d4lcvd_:
View in 3D Domains from other chains: (mouse over for more information) d4lcva_, d4lcvb1, d4lcvb2, d4lcvc_ |