PDB entry 4lcv

View 4lcv on RCSB PDB site
Description: Crystal Structure of DOC2B C2A domain
Class: metal binding protein
Keywords: C2, Calcium binding protein, METAL BINDING PROTEIN
Deposited on 2013-06-23, released 2013-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Double C2-like domain-containing protein beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Doc2b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lcva_
  • Chain 'B':
    Compound: Double C2-like domain-containing protein beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Doc2b
    Database cross-references and differences (RAF-indexed):
    • Uniprot P70610 (7-End)
      • expression tag (6)
    Domains in SCOPe 2.07: d4lcvb1, d4lcvb2
  • Chain 'C':
    Compound: Double C2-like domain-containing protein beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Doc2b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lcvc_
  • Chain 'D':
    Compound: Double C2-like domain-containing protein beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Doc2b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lcvd_
  • Heterogens: SO4, BME, CA, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lcvA (A:)
    ggsgsgstalgtldfsllydqennalhctiskakglkpmdhngladpyvklhllpgaska
    nklrtktlrntlnpswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkk
    lkpnhtktfsiclekqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lcvA (A:)
    algtldfsllydqennalhctiskakglkpladpyvklhllpgaskanklrtktlrntln
    pswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkklkpnhtktfsicl
    ekq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lcvB (B:)
    ggsgsgstalgtldfsllydqennalhctiskakglkpmdhngladpyvklhllpgaska
    nklrtktlrntlnpswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkk
    lkpnhtktfsiclekqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lcvB (B:)
    stalgtldfsllydqennalhctiskakglkpmdhngladpyvklhllpgaskanklrtk
    tlrntlnpswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkklkpnht
    ktfsiclekql
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lcvC (C:)
    ggsgsgstalgtldfsllydqennalhctiskakglkpmdhngladpyvklhllpgaska
    nklrtktlrntlnpswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkk
    lkpnhtktfsiclekqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lcvC (C:)
    talgtldfsllydqennalhctiskakglkpmdhngladpyvklhllpgaskanklrtkt
    lrntlnpswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkklkpnhtk
    tfsiclekq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lcvD (D:)
    ggsgsgstalgtldfsllydqennalhctiskakglkpmdhngladpyvklhllpgaska
    nklrtktlrntlnpswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkk
    lkpnhtktfsiclekqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lcvD (D:)
    algtldfsllydqennalhctiskakglkpmdladpyvklhllpgaskanklrtktlrnt
    lnpswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkklkpnhtktfsi
    clekql