Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
Protein automated matches [190322] (4 species) not a true protein |
Species Synechococcus sp. [TaxId:32049] [194261] (4 PDB entries) |
Domain d4l2mb_: 4l2m B: [197421] automated match to d4i0vb_ complexed with cyn, heb, so4 |
PDB Entry: 4l2m (more details), 2.25 Å
SCOPe Domain Sequences for d4l2mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l2mb_ a.1.1.1 (B:) automated matches {Synechococcus sp. [TaxId: 32049]} aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv lnr
Timeline for d4l2mb_: