Lineage for d4l2mb_ (4l2m B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299349Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 2299409Protein automated matches [190322] (4 species)
    not a true protein
  7. 2299420Species Synechococcus sp. [TaxId:32049] [194261] (4 PDB entries)
  8. 2299428Domain d4l2mb_: 4l2m B: [197421]
    automated match to d4i0vb_
    complexed with cyn, heb, so4

Details for d4l2mb_

PDB Entry: 4l2m (more details), 2.25 Å

PDB Description: Crystal structure of the 2/2 hemoglobin from Synechococcus sp. PCC 7002 in the cyanomet state and with covalently attached heme
PDB Compounds: (B:) Cyanoglobin

SCOPe Domain Sequences for d4l2mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l2mb_ a.1.1.1 (B:) automated matches {Synechococcus sp. [TaxId: 32049]}
aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
lnr

SCOPe Domain Coordinates for d4l2mb_:

Click to download the PDB-style file with coordinates for d4l2mb_.
(The format of our PDB-style files is described here.)

Timeline for d4l2mb_: