PDB entry 4l2m
View 4l2m on RCSB PDB site
Description: Crystal structure of the 2/2 hemoglobin from Synechococcus sp. PCC 7002 in the cyanomet state and with covalently attached heme
Class: unknown function
Keywords: group I 2/2 hemoglobin, GlbN, trHbN, cyanomet hemoglobin, histidine-heme covalent linkage, truncated hemoglobin, UNKNOWN FUNCTION
Deposited on
2013-06-04, released
2013-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated
2014-02-19, with a file datestamp of
2014-02-14.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.221
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cyanoglobin
Species: Synechococcus sp. [TaxId:32049]
Gene: glbN, SYNPCC7002_A1621
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4l2ma_ - Chain 'B':
Compound: Cyanoglobin
Species: Synechococcus sp. [TaxId:32049]
Gene: glbN, SYNPCC7002_A1621
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4l2mb_ - Heterogens: HEB, CYN, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4l2mA (A:)
aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
lnr
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4l2mB (B:)
aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
lnr