PDB entry 4l2m

View 4l2m on RCSB PDB site
Description: Crystal structure of the 2/2 hemoglobin from Synechococcus sp. PCC 7002 in the cyanomet state and with covalently attached heme
Class: unknown function
Keywords: group I 2/2 hemoglobin, GlbN, trHbN, cyanomet hemoglobin, histidine-heme covalent linkage, truncated hemoglobin, UNKNOWN FUNCTION
Deposited on 2013-06-04, released 2013-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.221
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyanoglobin
    Species: Synechococcus sp. [TaxId:32049]
    Gene: glbN, SYNPCC7002_A1621
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l2ma_
  • Chain 'B':
    Compound: Cyanoglobin
    Species: Synechococcus sp. [TaxId:32049]
    Gene: glbN, SYNPCC7002_A1621
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l2mb_
  • Heterogens: HEB, CYN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l2mA (A:)
    aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
    pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
    lnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l2mB (B:)
    aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
    pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
    lnr