Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (18 species) not a true protein |
Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [226702] (1 PDB entry) |
Domain d4l11a_: 4l11 A: [224546] automated match to d1q3ea_ |
PDB Entry: 4l11 (more details), 2.55 Å
SCOPe Domain Sequences for d4l11a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l11a_ b.82.3.0 (A:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]} taryhtqmlrvrefirfhqipnplrqrleeyfqhawtytngidmnsvlkgfpeclqadic lhlnrnllnncsafeaaspgclralslkfktthappgdilvhkgdvltylyfiargsiei lkddvvmailgkddifgenpcihstlgksnsnvkaltycdlhkihrddlldvldlfpefy dsfvnsleitynmrdeeq
Timeline for d4l11a_: