Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (40 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225370] (7 PDB entries) |
Domain d4krea3: 4kre A:576-857 [307649] Other proteins in same PDB: d4krea1, d4krea2 automated match to d4olaa3 protein/RNA complex |
PDB Entry: 4kre (more details), 1.75 Å
SCOPe Domain Sequences for d4krea3:
Sequence, based on SEQRES records: (download)
>d4krea3 c.55.3.0 (A:576-857) automated matches {Human (Homo sapiens) [TaxId: 9606]} lvphqrsavfqqpviflgadvthppagdgkkpsitavvgsmdahpsrycatvrvqrprqe iiedlsymvrelliqfykstrfkptriifyrdgvpegqlpqilhyellairdaciklekd yqpgityivvqkrhhtrlfcadknerigksgnipagttvdtnithpfefdfylcshagiq gtsrpshyyvlwddnrftadelqiltyqlchtyvrctrsvsipapayyarlvafraryhl vdkehdsgegshisgqsngrdpqalakavqvhqdtlrtmyfa
>d4krea3 c.55.3.0 (A:576-857) automated matches {Human (Homo sapiens) [TaxId: 9606]} lvphqrsavfqqpviflgadvthppkkpsitavvgsmdahpsrycatvrvqrprqeiied lsymvrelliqfykstrfkptriifyrdgvpegqlpqilhyellairdaciklekdyqpg ityivvqkrhhtrlfcadknerigksgnipagttvdtnithpfefdfylcshagiqgtsr pshyyvlwddnrftadelqiltyqlchtyvrctrsvsipapayyarlvafraryhlvdrd pqalakavqvhqdtlrtmyfa
Timeline for d4krea3: