Lineage for d4krea1 (4kre A:18-410)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047718Superfamily b.34.14: PAZ domain [101690] (2 families) (S)
  5. 2047758Family b.34.14.0: automated matches [310679] (1 protein)
    not a true family
  6. 2047759Protein automated matches [310889] (1 species)
    not a true protein
  7. 2047760Species Human (Homo sapiens) [TaxId:9606] [311392] (4 PDB entries)
  8. 2047761Domain d4krea1: 4kre A:18-410 [307647]
    Other proteins in same PDB: d4krea2, d4krea3
    automated match to d4olaa1
    protein/RNA complex

Details for d4krea1

PDB Entry: 4kre (more details), 1.75 Å

PDB Description: Structure of Human Argonaute-1 bound to endogenous Sf9 RNA
PDB Compounds: (A:) Protein argonaute-1

SCOPe Domain Sequences for d4krea1:

Sequence, based on SEQRES records: (download)

>d4krea1 b.34.14.0 (A:18-410) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqvfqaprrpgigtvgkpikllanyfevdipkidvyhyevdikpdkcprrvnrevveymv
qhfkpqifgdrkpvydgkkniytvtalpignervdfevtipgegkdrifkvsikwlaivs
wrmlhealvsgqipvplesvqaldvamrhlasmrytpvgrsffsppegyyhplgggrevw
fgfhqsvrpamwkmmlnidvsatafykaqpviefmcevldirnideqpkpltdsqrvrft
keikglkvevthcgqmkrkyrvcnvtrrpashqtfplqlesgqtvectvaqyfkqkynlq
lkyphlpclqvgqeqkhtylplevcnivagqrcikkltdnqtstmikatarsapdrqeei
srlmknasynldpyiqefgikvkddmtevtgrv

Sequence, based on observed residues (ATOM records): (download)

>d4krea1 b.34.14.0 (A:18-410) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqvfqaprrpgigtvgkpikllanyfevdipkidvyhyevdikpdkcprrvnrevveymv
qhfkifgdrkpvydgkkniytvtalpigervdfevtrifkvsikwlaivswrmlhealvs
gqipvplesvqaldvamrhlasmrytpvgrsffsppegyyhplgggrevwfgfhqsvrpa
mwkmmlnidvsatafykaqpviefmcevldirqpkpltdsqrvrftkeikglkvevthcg
krkyrvcnvtrrpashqtfplqlesgqtvectvaqyfkqkynlqlkyphlpclqvghtyl
plevcnivagqrcikkltdnqtstmikatarsapdrqeeisrlmknasynldpyiqefgi
kvkddmtevtgrv

SCOPe Domain Coordinates for d4krea1:

Click to download the PDB-style file with coordinates for d4krea1.
(The format of our PDB-style files is described here.)

Timeline for d4krea1:

  • d4krea1 is new in SCOPe 2.06-stable