Lineage for d4kg4a_ (4kg4 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211807Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2211808Protein automated matches [191036] (16 species)
    not a true protein
  7. 2211815Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [235108] (4 PDB entries)
  8. 2211819Domain d4kg4a_: 4kg4 A: [235162]
    automated match to d2a6tb1
    mutant

Details for d4kg4a_

PDB Entry: 4kg4 (more details), 1.8 Å

PDB Description: crystal structure of saccharomyces cerevisiae dcp2 nudix domain (e198q mutation)
PDB Compounds: (A:) mRNA-decapping enzyme subunit 2

SCOPe Domain Sequences for d4kg4a_:

Sequence, based on SEQRES records: (download)

>d4kg4a_ d.113.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ipvrgaaifnenlskillvqgtesdswsfprgkiskdendidccirevkeeigfdltdyi
ddnqfierniqgknykiflisgvsevfnfkpqvrnqidkiewfdfkkisktmyksnikyy
linsmmrplsmwlrhqrqikn

Sequence, based on observed residues (ATOM records): (download)

>d4kg4a_ d.113.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ipvrgaaifnenlskillvqgtesdswsfprgkiskdendidccirevkeeigfdltdyi
ddnqfierniqgknykiflisgvsevfnfkpqvrnqidkiewfdfkkisktmnikyylin
smmrplsmwlrhqrqikn

SCOPe Domain Coordinates for d4kg4a_:

Click to download the PDB-style file with coordinates for d4kg4a_.
(The format of our PDB-style files is described here.)

Timeline for d4kg4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4kg4b_