Lineage for d4k8oa_ (4k8o A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870403Protein automated matches [190723] (8 species)
    not a true protein
  7. 2870421Species Norway rat (Rattus norvegicus) [TaxId:10116] [187882] (4 PDB entries)
  8. 2870429Domain d4k8oa_: 4k8o A: [259358]
    automated match to d2ixfa_
    complexed with atp, cit, mg, ni; mutant

Details for d4k8oa_

PDB Entry: 4k8o (more details), 2.65 Å

PDB Description: crystal structure of the atpase domain of tap1 with atp (d645n, d651a mutant)
PDB Compounds: (A:) antigen peptide transporter 1

SCOPe Domain Sequences for d4k8oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k8oa_ c.37.1.12 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gslaplnmkglvkfqdvsfaypnhpnvqvlqgltftlypgkvtalvgpngsgkstvaall
qnlyqptggkvlldgeplvqydhhylhtqvaavgqepllfgrsfreniaygltrtptmee
itavamesgahdfisgfpqgydtevgetgnqlsggqrqavalaralirkprllildnats
alaagnqlrvqrllyespewasrtvllitqqlslaerahhilflkegsvceqgthlqlme
rggcyrsmvealaa

SCOPe Domain Coordinates for d4k8oa_:

Click to download the PDB-style file with coordinates for d4k8oa_.
(The format of our PDB-style files is described here.)

Timeline for d4k8oa_: