Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
Protein automated matches [190723] (8 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [187882] (4 PDB entries) |
Domain d4k8oa_: 4k8o A: [259358] automated match to d2ixfa_ complexed with atp, cit, mg, ni; mutant |
PDB Entry: 4k8o (more details), 2.65 Å
SCOPe Domain Sequences for d4k8oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k8oa_ c.37.1.12 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} gslaplnmkglvkfqdvsfaypnhpnvqvlqgltftlypgkvtalvgpngsgkstvaall qnlyqptggkvlldgeplvqydhhylhtqvaavgqepllfgrsfreniaygltrtptmee itavamesgahdfisgfpqgydtevgetgnqlsggqrqavalaralirkprllildnats alaagnqlrvqrllyespewasrtvllitqqlslaerahhilflkegsvceqgthlqlme rggcyrsmvealaa
Timeline for d4k8oa_: