Lineage for d4jy7a_ (4jy7 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1375163Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1376104Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 1376114Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 1376115Protein automated matches [193326] (5 species)
    not a true protein
  7. 1376116Species Acinetobacter baumannii [TaxId:575584] [196867] (11 PDB entries)
  8. 1376124Domain d4jy7a_: 4jy7 A: [196868]
    automated match to d2ptha_
    complexed with act, edo, gol, peg

Details for d4jy7a_

PDB Entry: 4jy7 (more details), 1.9 Å

PDB Description: Crystal structure of Acinetobacter baumannii Peptidyl-tRNA Hydrolase
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4jy7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jy7a_ c.56.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

SCOPe Domain Coordinates for d4jy7a_:

Click to download the PDB-style file with coordinates for d4jy7a_.
(The format of our PDB-style files is described here.)

Timeline for d4jy7a_: