PDB entry 4jy7

View 4jy7 on RCSB PDB site
Description: Crystal structure of Acinetobacter baumannii Peptidyl-tRNA Hydrolase
Class: hydrolase
Keywords: Peptidyl-tRNA hydrolase, enzyme, Molecular Conformation, Inhibition, HYDROLASE
Deposited on 2013-03-29, released 2013-04-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.161
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Acinetobacter baumannii [TaxId:575584]
    Gene: HMPREF0010_01329, pth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4jy7a_
  • Heterogens: GOL, EDO, ACT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jy7A (A:)
    msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
    rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
    ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
    pqamnqinaykpa