Lineage for d4jmia_ (4jmi A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745754Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 1745790Family a.118.3.0: automated matches [191673] (1 protein)
    not a true family
  6. 1745791Protein automated matches [191283] (2 species)
    not a true protein
  7. 1745795Species Human (Homo sapiens) [TaxId:9606] [189904] (8 PDB entries)
  8. 1745797Domain d4jmia_: 4jmi A: [228458]
    automated match to d1re0b_

Details for d4jmia_

PDB Entry: 4jmi (more details), 1.5 Å

PDB Description: Sec7 domain of ARNO, an exchange factor, at 1.5 Angstrom resolution
PDB Compounds: (A:) Cytohesin-2

SCOPe Domain Sequences for d4jmia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jmia_ a.118.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigd
ylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycl
cnpgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeellrn
lydsirnepfki

SCOPe Domain Coordinates for d4jmia_:

Click to download the PDB-style file with coordinates for d4jmia_.
(The format of our PDB-style files is described here.)

Timeline for d4jmia_: