Class a: All alpha proteins [46456] (286 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.3: Sec7 domain [48425] (2 families) |
Family a.118.3.0: automated matches [191673] (1 protein) not a true family |
Protein automated matches [191283] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189904] (8 PDB entries) |
Domain d4jmia_: 4jmi A: [228458] automated match to d1re0b_ |
PDB Entry: 4jmi (more details), 1.5 Å
SCOPe Domain Sequences for d4jmia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jmia_ a.118.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hmsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigd ylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycl cnpgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeellrn lydsirnepfki
Timeline for d4jmia_: