![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.3: Sec7 domain [48425] (2 families) ![]() |
![]() | Family a.118.3.0: automated matches [191673] (1 protein) not a true family |
![]() | Protein automated matches [191283] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189904] (8 PDB entries) |
![]() | Domain d4jmia1: 4jmi A:56-245 [228458] Other proteins in same PDB: d4jmia2 automated match to d1re0b_ |
PDB Entry: 4jmi (more details), 1.5 Å
SCOPe Domain Sequences for d4jmia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jmia1 a.118.3.0 (A:56-245) automated matches {Human (Homo sapiens) [TaxId: 9606]} sktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdyl gereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqryclcn pgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeellrnly dsirnepfki
Timeline for d4jmia1: