Lineage for d4jmia1 (4jmi A:56-245)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726245Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 2726283Family a.118.3.0: automated matches [191673] (1 protein)
    not a true family
  6. 2726284Protein automated matches [191283] (3 species)
    not a true protein
  7. 2726288Species Human (Homo sapiens) [TaxId:9606] [189904] (8 PDB entries)
  8. 2726290Domain d4jmia1: 4jmi A:56-245 [228458]
    Other proteins in same PDB: d4jmia2
    automated match to d1re0b_

Details for d4jmia1

PDB Entry: 4jmi (more details), 1.5 Å

PDB Description: Sec7 domain of ARNO, an exchange factor, at 1.5 Angstrom resolution
PDB Compounds: (A:) Cytohesin-2

SCOPe Domain Sequences for d4jmia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jmia1 a.118.3.0 (A:56-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdyl
gereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqryclcn
pgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeellrnly
dsirnepfki

SCOPe Domain Coordinates for d4jmia1:

Click to download the PDB-style file with coordinates for d4jmia1.
(The format of our PDB-style files is described here.)

Timeline for d4jmia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jmia2