SCOPe 2.07: Domain d4jmia1: 4jmi A:56-245

Lineage for d4jmia1 (4jmi A:56-245)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.3: Sec7 domain [48425] (2 families)

5. Family a.118.3.0: automated matches [191673] (1 protein)
   not a true family

6. Protein automated matches [191283] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189904] (8 PDB entries)

8. Domain d4jmia1: 4jmi A:56-245 [228458]
   Other proteins in same PDB: d4jmia2
   automated match to d1re0b_

Details for d4jmia1

PDB Entry: 4jmi, 1.5 Å

PDB Description: Sec7 domain of ARNO, an exchange factor, at 1.5 Angstrom resolution

PDB Compounds: (A:) Cytohesin-2

SCOPe Domain Sequences for d4jmia1:

Sequence; same for both SEQRES and ATOM records:

>d4jmia1 a.118.3.0 (A:56-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdyl
gereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqryclcn
pgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeellrnly
dsirnepfki

Timeline for d4jmia1:

• d4jmia1 first appeared in SCOPe 2.03, called d4jmia_
  
• d4jmia1 appears in SCOPe 2.06