Lineage for d4je1b_ (4je1 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132842Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2133248Protein automated matches [190100] (19 species)
    not a true protein
  7. 2133419Species Burkholderia cenocepacia [TaxId:216591] [196688] (1 PDB entry)
  8. 2133421Domain d4je1b_: 4je1 B: [196689]
    Other proteins in same PDB: d4je1a2
    automated match to d1q98a_
    complexed with edo

Details for d4je1b_

PDB Entry: 4je1 (more details), 1.4 Å

PDB Description: crystal structure of thiol peroxidase from burkholderia cenocepacia j2315
PDB Compounds: (B:) Probable thiol peroxidase

SCOPe Domain Sequences for d4je1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4je1b_ c.47.1.10 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
skvtlggnpidlagtfpavgaqaadfklvgkdladlslasfagkrkvlnivpsldtptca
tstrkfneaassldntvvivvsadlpfaatrfctteglanvvtastfrtgrafanaygvd
vtsgplngltaravvvldaqdkvihaelvgeikdepnydaalaalk

SCOPe Domain Coordinates for d4je1b_:

Click to download the PDB-style file with coordinates for d4je1b_.
(The format of our PDB-style files is described here.)

Timeline for d4je1b_: