SCOPe 2.06: Domain d4je1a1: 4je1 A:1-167

Lineage for d4je1a1 (4je1 A:1-167)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (19 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [196688] (1 PDB entry)

8. Domain d4je1a1: 4je1 A:1-167 [202740]
   Other proteins in same PDB: d4je1a2
   automated match to d4je1b_
   complexed with edo

Details for d4je1a1

PDB Entry: 4je1, 1.4 Å

PDB Description: crystal structure of thiol peroxidase from burkholderia cenocepacia j2315

PDB Compounds: (A:) Probable thiol peroxidase

SCOPe Domain Sequences for d4je1a1:

Sequence; same for both SEQRES and ATOM records:

>d4je1a1 c.47.1.10 (A:1-167) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
mskvtlggnpidlagtfpavgaqaadfklvgkdladlslasfagkrkvlnivpsldtptc
atstrkfneaassldntvvivvsadlpfaatrfctteglanvvtastfrtgrafanaygv
dvtsgplngltaravvvldaqdkvihaelvgeikdepnydaalaalk

Timeline for d4je1a1:

• d4je1a1 first appeared in SCOPe 2.03, called d4je1a_
  
• d4je1a1 was called d4je1a_ in SCOPe 2.05
  
• d4je1a1 appears in SCOPe 2.07
  
• d4je1a1 appears in the current release, SCOPe 2.08