Lineage for d4ja8b_ (4ja8 B:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
consists of two intertwined (sub)domains related by pseudo dyad; duplication
3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the restSuperfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) 
the constituent families form similar dimers
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
the active site is between the two identical subunits
Protein automated matches [190072] (18 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [189131] (9 PDB entries) 
Domain d4ja8b_: 4ja8 B: [197105]
automated match to d1lwda_
complexed with 1k9, ca, gol, ndp; mutant
Details for d4ja8b_
PDB Entry: 4ja8 (more details), 1.55 Å
PDB Description: complex of mitochondrial isocitrate dehydrogenase r140q mutant with agi-6780 inhibitor
PDB Compounds: (B:) Isocitrate dehydrogenase [NADP], mitochondrialSCOPe Domain Sequences for d4ja8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ja8b_ c.77.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtidsal
atqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprlvp
gwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmgmy
ntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdknk
iwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgkti
eaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlekvc
vetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldra
SCOPe Domain Coordinates for d4ja8b_:
Click to download the PDB-style file with coordinates for d4ja8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ja8b_:
- d4ja8b_ first appeared in SCOPe 2.02
- d4ja8b_ appears in SCOPe 2.03
- d4ja8b_ appears in SCOPe 2.05
- d4ja8b_ appears in the current release, SCOPe 2.08
View in 3D
