| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
Superfamily f.6.1: Leukocidin-like [56959] (3 families) ![]() |
| Family f.6.1.0: automated matches [227293] (1 protein) not a true family |
| Protein automated matches [227114] (5 species) not a true protein |
| Species Staphylococcus phage [TaxId:71366] [236419] (5 PDB entries) |
| Domain d4iyaa_: 4iya A: [236421] automated match to d3lkfa_ complexed with edo, flc; mutant |
PDB Entry: 4iya (more details), 1.55 Å
SCOPe Domain Sequences for d4iyaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iyaa_ f.6.1.0 (A:) automated matches {Staphylococcus phage [TaxId: 71366]}
nnienigdgaevvkrtedtssdkwgvtqniqfdfvkdkkynkdalilkmqgfinskttyy
nykntdhikamrwpfqyniglktndpnvdlinylpknkidsvnvsqtlgyniggnfnsgp
stggngsfnysktisynqqnyisevehqnsksvqwgikansfitslgkmsghdpnlfvgy
kpysqnprdyfvpdnelpplvhsgfnpsfiatvshekgsgdtsefeitygrnmdvthatr
rtthygnsalegsrihnafvnrnytvkyevnwktheikvkghn
Timeline for d4iyaa_: