Lineage for d4ixna1 (4ixn A:1-223)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477146Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2477329Protein Hypothetical protein YjiA, N-terminal domain [89671] (1 species)
    homologue of the cobalamin biosynthesis protein CobW
  7. 2477330Species Escherichia coli [TaxId:562] [89672] (3 PDB entries)
  8. 2477331Domain d4ixna1: 4ixn A:1-223 [234918]
    Other proteins in same PDB: d4ixna2, d4ixnb2
    automated match to d1nija1
    complexed with so4, zn; mutant

Details for d4ixna1

PDB Entry: 4ixn (more details), 2.05 Å

PDB Description: Crystal Structure of Zn(II)-bound E37A,C66A,C67A triple mutant YjiA GTPase
PDB Compounds: (A:) Uncharacterized GTP-binding protein YjiA

SCOPe Domain Sequences for d4ixna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ixna1 c.37.1.10 (A:1-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}
mnpiavtlltgflgagkttllrhilneqhgykiavianefgevsvddqligdratqiktl
tngciaasrsneledalldlldnldkgniqfdrlviectgmadpgpiiqtffshevlcqr
ylldgvialvdavhadeqmnqftiaqsqvgyadrilltktdvageaeklherlarinara
pvytvthgdidlgllfntngfmleenvvstkprfhfiadkqnd

SCOPe Domain Coordinates for d4ixna1:

Click to download the PDB-style file with coordinates for d4ixna1.
(The format of our PDB-style files is described here.)

Timeline for d4ixna1:

2477331
d4ixna1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4ixna2