| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
| Protein Hypothetical protein YjiA, N-terminal domain [89671] (1 species) homologue of the cobalamin biosynthesis protein CobW |
| Species Escherichia coli [TaxId:562] [89672] (3 PDB entries) |
| Domain d4ixna1: 4ixn A:1-223 [234918] Other proteins in same PDB: d4ixna2, d4ixnb2 automated match to d1nija1 complexed with so4, zn; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 4ixn (more details), 2.05 Å
SCOPe Domain Sequences for d4ixna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ixna1 c.37.1.10 (A:1-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}
mnpiavtlltgflgagkttllrhilneqhgykiavianefgevsvddqligdratqiktl
tngciaasrsneledalldlldnldkgniqfdrlviectgmadpgpiiqtffshevlcqr
ylldgvialvdavhadeqmnqftiaqsqvgyadrilltktdvageaeklherlarinara
pvytvthgdidlgllfntngfmleenvvstkprfhfiadkqnd
Timeline for d4ixna1: