Lineage for d4hebb_ (4heb B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1603870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1604067Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 1604097Family c.51.4.2: Maf-like [52976] (3 proteins)
    automatically mapped to Pfam PF02545
  6. 1604107Protein automated matches [227099] (1 species)
    not a true protein
  7. 1604108Species Bacillus subtilis [TaxId:1423] [226507] (1 PDB entry)
  8. 1604110Domain d4hebb_: 4heb B: [222550]
    automated match to d1ex2a_
    complexed with unx

Details for d4hebb_

PDB Entry: 4heb (more details), 2.26 Å

PDB Description: The Crystal structure of Maf protein of Bacillus subtilis
PDB Compounds: (B:) Septum formation protein Maf

SCOPe Domain Sequences for d4hebb_:

Sequence, based on SEQRES records: (download)

>d4hebb_ c.51.4.2 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tkplilasqsprrkelldllqlpysiivseveeklnrnfspeenvqwlakqkakavadlh
phaivigadtmvcldgeclgkpqdqeeaasmlrrlsgrshsvitavsiqaenhsetfydk
tevafwslseeeiwtyietkepmdkagaygiqgrgalfvkkidgdyysvmglpisktmra
lrhfdir

Sequence, based on observed residues (ATOM records): (download)

>d4hebb_ c.51.4.2 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tkplilasqsprrkelldllqlpysiivsevnrnfspeenvqwlakqkakavadlhphai
vigadtmvcldgeclgkpqdqeeaasmlrrlsgrshsvitavsiqaenhsetfydkteva
fwslseeeiwtyietkepmdkagaygiqgrgalfvkkidgdyysvmglpisktmralrhf
dir

SCOPe Domain Coordinates for d4hebb_:

Click to download the PDB-style file with coordinates for d4hebb_.
(The format of our PDB-style files is described here.)

Timeline for d4hebb_: