SCOPe 2.03: Domain d4hebb_: 4heb B:

Lineage for d4hebb_ (4heb B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.2: Maf-like [52976] (3 proteins)
   automatically mapped to Pfam PF02545

6. Protein automated matches [227099] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [226507] (1 PDB entry)

8. Domain d4hebb_: 4heb B: [222550]
   automated match to d1ex2a_
   complexed with unx

Details for d4hebb_

PDB Entry: 4heb, 2.26 Å

PDB Description: The Crystal structure of Maf protein of Bacillus subtilis

PDB Compounds: (B:) Septum formation protein Maf

SCOPe Domain Sequences for d4hebb_:

Sequence, based on SEQRES records:

>d4hebb_ c.51.4.2 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tkplilasqsprrkelldllqlpysiivseveeklnrnfspeenvqwlakqkakavadlh
phaivigadtmvcldgeclgkpqdqeeaasmlrrlsgrshsvitavsiqaenhsetfydk
tevafwslseeeiwtyietkepmdkagaygiqgrgalfvkkidgdyysvmglpisktmra
lrhfdir

Sequence, based on observed residues (ATOM records):

>d4hebb_ c.51.4.2 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tkplilasqsprrkelldllqlpysiivsevnrnfspeenvqwlakqkakavadlhphai
vigadtmvcldgeclgkpqdqeeaasmlrrlsgrshsvitavsiqaenhsetfydkteva
fwslseeeiwtyietkepmdkagaygiqgrgalfvkkidgdyysvmglpisktmralrhf
dir

Timeline for d4hebb_:

• d4hebb_ is new in SCOPe 2.03-stable
  
• d4hebb_ appears in SCOPe 2.04
  
• d4hebb_ appears in the current release, SCOPe 2.08