Lineage for d4h1qa_ (4h1q A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) 
Protein Gelatinase B (MMP-9) [75496] (1 species) Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries) 
Domain d4h1qa_: 4h1q A: [202351]
automated match to d4h1qb_
complexed with 0xx, ca, zn; mutant
Details for d4h1qa_
PDB Entry: 4h1q (more details), 1.59 Å
PDB Description: crystal structure of mutant mmp-9 catalytic domain in complex with a twin inhibitor.
PDB Compounds: (A:) Matrix metalloproteinase-9SCOPe Domain Sequences for d4h1qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h1qa_ d.92.1.11 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
halgldhssvpealmypmyrftegpplhkddvngirhlyg
SCOPe Domain Coordinates for d4h1qa_:
Click to download the PDB-style file with coordinates for d4h1qa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4h1qa_:
- d4h1qa_ first appeared in SCOPe 2.03
- d4h1qa_ appears in SCOPe 2.07
View in 3D
