Lineage for d4h1qa_ (4h1q A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423492Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1423493Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1423977Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1424088Protein Gelatinase B (MMP-9) [75496] (1 species)
  7. 1424089Species Human (Homo sapiens) [TaxId:9606] [75497] (13 PDB entries)
  8. 1424090Domain d4h1qa_: 4h1q A: [202351]
    automated match to d4h1qb_
    complexed with 0xx, ca, zn; mutant

Details for d4h1qa_

PDB Entry: 4h1q (more details), 1.59 Å

PDB Description: crystal structure of mutant mmp-9 catalytic domain in complex with a twin inhibitor.
PDB Compounds: (A:) Matrix metalloproteinase-9

SCOPe Domain Sequences for d4h1qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h1qa_ d.92.1.11 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
halgldhssvpealmypmyrftegpplhkddvngirhlyg

SCOPe Domain Coordinates for d4h1qa_:

Click to download the PDB-style file with coordinates for d4h1qa_.
(The format of our PDB-style files is described here.)

Timeline for d4h1qa_: