PDB entry 4h1q

View 4h1q on RCSB PDB site
Description: Crystal structure of mutant MMP-9 catalytic domain in complex with a twin inhibitor.
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: HYDROLASE/TWIN INHIBITOR, Zincin-like, Gelatinase, Collagenase (Catalytic Domain), HYDROLASE-HYDROLASE inhibitor complex
Deposited on 2012-09-11, released 2013-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix metalloproteinase-9
    Species: Homo sapiens [TaxId:9606]
    Gene: CLG4B, MMP9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14780 (0-104)
    • Uniprot P14780 (106-159)
      • engineered mutation (117)
    Domains in SCOPe 2.08: d4h1qa_
  • Chain 'B':
    Compound: Matrix metalloproteinase-9
    Species: Homo sapiens [TaxId:9606]
    Gene: CLG4B, MMP9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14780 (0-104)
    • Uniprot P14780 (106-159)
      • engineered mutation (117)
    Domains in SCOPe 2.08: d4h1qb_
  • Heterogens: ZN, CA, 0XX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h1qA (A:)
    fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
    fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
    halgldhssvpealmypmyrftegpplhkddvngirhlyg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h1qB (B:)
    fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
    fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
    halgldhssvpealmypmyrftegpplhkddvngirhlyg