Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (12 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [189718] (28 PDB entries) |
Domain d4gyqc_: 4gyq C: [194621] automated match to d3srxa_ complexed with edo, mg; mutant |
PDB Entry: 4gyq (more details), 1.35 Å
SCOPe Domain Sequences for d4gyqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gyqc_ d.157.1.0 (C:) automated matches {Klebsiella pneumoniae [TaxId: 573]} tigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtaw tddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeg mvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikds kakslgnlgaadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
Timeline for d4gyqc_: